PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00463.1_g00020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 258aa    MW: 29310.6 Da    PI: 9.1663
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00463.1_g00020.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.26.7e-171562148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             rg+WT+ Ed++l+d+v   G g W+t ++  g++R++k+c++rw++yl
  Rsa1.0_00463.1_g00020.1 15 RGAWTEKEDKILKDYVMINGEGKWSTLPNQAGLKRCGKSCRLRWRNYL 62
                             89*********************************************7 PP

2Myb_DNA-binding52.51.1e-1668112147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              rg+ + +E+el+++++++lG++ W++Ia +++ gRt++++k++w++ 
  Rsa1.0_00463.1_g00020.1  68 RGNISSDEEELIIRLHNLLGNR-WALIAGRLP-GRTDNEIKNHWNTN 112
                              78999*****************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.2E-22865IPR009057Homeodomain-like
PROSITE profilePS5129416.6411062IPR017930Myb domain
SuperFamilySSF466892.36E-2813109IPR009057Homeodomain-like
SMARTSM007172.8E-121464IPR001005SANT/Myb domain
PfamPF002491.3E-141562IPR001005SANT/Myb domain
CDDcd001674.66E-91762No hitNo description
PROSITE profilePS5129424.33563117IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.1E-2366117IPR009057Homeodomain-like
SMARTSM007178.6E-1667115IPR001005SANT/Myb domain
PfamPF002499.8E-1568113IPR001005SANT/Myb domain
CDDcd001674.27E-1172113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006633Biological Processfatty acid biosynthetic process
GO:0006970Biological Processresponse to osmotic stress
GO:0010023Biological Processproanthocyanidin biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MMRKRASVKK EELNRGAWTE KEDKILKDYV MINGEGKWST LPNQAGLKRC GKSCRLRWRN  60
YLRPGIKRGN ISSDEEELII RLHNLLGNRW ALIAGRLPGR TDNEIKNHWN TNLRKTLPKS  120
QTNQQKSIKD FNSNNMNKVC VIRPKAIRFP KTLTIQKQSS IGCTSLLTVK ENVMDHQAGS  180
PSLLGDLKID FDKIHSEFLF SDLMDLDGLG CGNVMSLVSS DEVLGDYVPA DASCHGNLDL  240
NRPFTSCLQE DCLWNFNC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-261211724128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM9756640.0KM975664.1 Brassica napus MYB transcription factor 123-1.1 (MYB123-1.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009108019.11e-171PREDICTED: transcription factor TT2
SwissprotQ9FJA21e-125TT2_ARATH; Transcription factor TT2
TrEMBLA0A0N7AML81e-171A0A0N7AML8_BRANA; MYB transcription factor 123-1.1
TrEMBLM4F3821e-171M4F382_BRARP; Uncharacterized protein
STRINGBra035532.1-P1e-170(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35550.11e-126MYB family protein